SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_004789662.1.86464 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_004789662.1.86464
Domain Number - Region: 30-88
Classification Level Classification E-value
Superfamily Dhaf3308-like 0.0131
Family Dhaf3308-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_004789662.1.86464
Sequence length 104
Comment preprotein translocase subunit YajC [Borreliella afzelii]; AA=GCF_000304735.1; RF=representative genome; TAX=1239934; STAX=29518; NAME=Borrelia afzelii HLJ01; strain=HLJ01; AL=Complete Genome; RT=Major
Sequence
MFLLQEFSSNSSFFRSLLVFAPVIAIFWFLVISPQRKEEKNKKEMIKNLKKGDKVLTIGG
IFGVVKKLGDTDVILELSPNIEAVFVKNSIDKVLSEKNEVKKVL
Download sequence
Identical sequences G0IQK1
WP_004789662.1.101990 WP_004789662.1.4002 WP_004789662.1.40725 WP_004789662.1.72423 WP_004789662.1.86464 WP_004789662.1.94617 gi|410679434|ref|YP_006931836.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]