SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_004821998.1.19192 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_004821998.1.19192
Domain Number - Region: 11-60
Classification Level Classification E-value
Superfamily L27 domain 0.00459
Family L27 domain 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_004821998.1.19192
Sequence length 70
Comment MULTISPECIES: hypothetical protein [Acinetobacter]; AA=GCF_000368485.1; RF=representative genome; TAX=1217656; STAX=106649; NAME=Acinetobacter guillouiae NIPH 991; strain=NIPH 991; AL=Scaffold; RT=Major
Sequence
MNVLDTINSELHQAAMLLDNISGKIQEAPELENRENILLIGKALSHIFELQKNIYEHRPD
LKNIHEQNND
Download sequence
Identical sequences A0A0Q7G116 N8YAU1
WP_004821998.1.19192 WP_004821998.1.22718

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]