SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_004824851.1.122 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_004824851.1.122
Domain Number - Region: 31-56
Classification Level Classification E-value
Superfamily Vasodilator-stimulated phosphoprotein, VASP, tetramerisation domain 0.017
Family Vasodilator-stimulated phosphoprotein, VASP, tetramerisation domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_004824851.1.122
Sequence length 104
Comment MULTISPECIES: cell division protein FtsB [Peptoniphilus]; AA=GCF_000176955.1; RF=na; TAX=596330; STAX=33031; NAME=Peptoniphilus lacrimalis 315-B; strain=315-B; AL=Contig; RT=Major
Sequence
MRTRRKSFPLIYAIIILITLIYFAFSMSKSIGLRNQKLEILSENRREISSLNNDIKNLKR
EINNADTIEFVEKVARDDLGMVKPREIVYIDKSKGSSFNLHRQN
Download sequence
Identical sequences A0A095ZP39 D1VTP1 D8FK94
WP_004824851.1.122 WP_004824851.1.35567 WP_004824851.1.53945

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]