SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_004911060.1.59762 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_004911060.1.59762
Domain Number - Region: 35-88
Classification Level Classification E-value
Superfamily N-terminal, heterodimerisation domain of RBP7 (RpoE) 0.0183
Family N-terminal, heterodimerisation domain of RBP7 (RpoE) 0.0078
Further Details:      
 
Domain Number - Region: 207-257
Classification Level Classification E-value
Superfamily Gametocyte protein Pfg27 0.0379
Family Gametocyte protein Pfg27 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_004911060.1.59762
Sequence length 315
Comment hypothetical protein [Acinetobacter junii]; AA=GCF_000430225.1; RF=na; TAX=1330047; STAX=40215; NAME=Acinetobacter junii MTCC 11364; strain=MTCC 11364; AL=Contig; RT=Major
Sequence
MIPSSENKINKLFKAKIEQFKQAFINTSRDVYTNEDGNLLHPSEFGINREEIVKNYLKNI
LPDRMEIGSGFVVTANGKVSTQCDIIIYDKTVTPLIRDEKNHRFFPIESVIAVGEIKSKL
SLTELKEALLKLAKIKSLRDVLFSPAYVYSLRNKESIDDYKPESDEFDQIVTFLICEKFT
FPIKKTPLTDIVSCYGESLPHRPFCHRHNMVLSMADGLLTYALDDETIYPFPSKIIDYIN
VDEEYNIAERKNVVERLNYRFIKPLNDESIEHIRHFTSILNIGLISVSVLFPDLANYIPK
EEKVEMFDCVQNYKF
Download sequence
Identical sequences S7WJ05
WP_004911060.1.13549 WP_004911060.1.4765 WP_004911060.1.59762

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]