SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_005027695.1.68439 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_005027695.1.68439
Domain Number - Region: 101-196
Classification Level Classification E-value
Superfamily Rap/Ran-GAP 0.00732
Family Rap/Ran-GAP 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_005027695.1.68439
Sequence length 208
Comment MULTISPECIES: NERD nuclease [Acinetobacter]; AA=GCF_000581035.1; RF=na; TAX=1310621; STAX=1310621; NAME=Acinetobacter sp. 869535; strain=869535; AL=Contig; RT=Major
Sequence
MLFNFIIIVAVIGLIAWISSPKFKGKLGEFTVKVHAKKYLSEEYIMLNDCTLPDEQTGTT
QIDHILLSPYGIFIIETKNYQGWIFGGERQKHWTQKIYKKSFRFQNPLYQNYKHIKVLES
VLKDVVEPEYLHSIIVFTPQSTFKTPMPANVLQGKAWTDYVKQFQQTVIPAMKLKRIKYH
LEKEILEKGWKTDRLHIENLKQKQEEQN
Download sequence
Identical sequences A0A062BVP3 A0A0E2GHW3
WP_005027695.1.36433 WP_005027695.1.37436 WP_005027695.1.58587 WP_005027695.1.63088 WP_005027695.1.68439 WP_005027695.1.7362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]