SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_005030359.1.27157 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_005030359.1.27157
Domain Number - Region: 22-43
Classification Level Classification E-value
Superfamily Cysteine-rich DNA binding domain, (DM domain) 0.017
Family Cysteine-rich DNA binding domain, (DM domain) 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_005030359.1.27157
Sequence length 79
Comment hypothetical protein [Acinetobacter bereziniae]; AA=GCF_000248295.1; RF=na; TAX=981324; STAX=106648; NAME=Acinetobacter bereziniae LMG 1003 = CIP 70.12; strain=LMG 1003; AL=Contig; RT=Major
Sequence
MRDQYTMDWCEDLEGLKYQPIINHGTVYAYNKHKCRCEFCKEAKAISNQQSALKAKMKAV
DFDIKGNSRPSGLVLGGGL
Download sequence
Identical sequences N9DIX1
WP_005030359.1.27157 WP_005030359.1.6941 WP_005030359.1.76589

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]