SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_005066936.1.28277 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_005066936.1.28277
Domain Number - Region: 21-52
Classification Level Classification E-value
Superfamily Myosin S1 fragment, N-terminal domain 0.0445
Family Myosin S1 fragment, N-terminal domain 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_005066936.1.28277
Sequence length 149
Comment MULTISPECIES: hypothetical protein [Acinetobacter calcoaceticus/baumannii complex]; AA=GCF_002166815.1; RF=na; TAX=1285584; STAX=106654; NAME=Acinetobacter nosocomialis P020; strain=P020; AL=Contig; RT=Major
Sequence
MKKLLLVSLLTFTSFAHAAPNVWQSSYAQGFIEYSIQDTKGNTLWVVCNDGAGDDYDHSA
HLQTKKNRYENTDSKYPLSFLLDGKTSVSPAGSTKWRNGANAWYDFSHGIAKAKKIDVFV
NNKKVTTFTPNPHSIKTVAKDIASCKAMF
Download sequence
Identical sequences A0A1Y5NQC1 A0A255U7A7
WP_005066936.1.100086 WP_005066936.1.11037 WP_005066936.1.13806 WP_005066936.1.19750 WP_005066936.1.24916 WP_005066936.1.28277 WP_005066936.1.41946 WP_005066936.1.45158 WP_005066936.1.46114 WP_005066936.1.4733 WP_005066936.1.5089 WP_005066936.1.52030 WP_005066936.1.53076 WP_005066936.1.60144 WP_005066936.1.61879 WP_005066936.1.65556 WP_005066936.1.77264 WP_005066936.1.77776 WP_005066936.1.8300 WP_005066936.1.83187 WP_005066936.1.83504 WP_005066936.1.85359 WP_005066936.1.85831

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]