SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_005075602.1.40405 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_005075602.1.40405
Domain Number - Region: 17-49
Classification Level Classification E-value
Superfamily TRAF domain-like 0.0305
Family MATH domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_005075602.1.40405
Sequence length 156
Comment hypothetical protein [Acinetobacter pittii]; AA=GCF_000836015.1; RF=na; TAX=48296; STAX=48296; NAME=Acinetobacter pittii; strain=DSM 25618; AL=Contig; RT=Major
Sequence
MKKILFLSLVSVLSSYTFAEDNSSIYRGLGTGTKDFLKFEILKKQGFIAKKATISRADYN
DIYKLKKRYQFMGQNVVLISDEYMSEYVGCCVSEGWGAVFKQISNLKLIEHFAKTNQCKI
SPIEKDSDYYGFKIRSLPKGNYYELSCRERDLDESQ
Download sequence
Identical sequences WP_005075602.1.3456 WP_005075602.1.40405 WP_005075602.1.89761

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]