SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_005303496.1.43483 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_005303496.1.43483
Domain Number - Region: 9-38
Classification Level Classification E-value
Superfamily PA2201 N-terminal domain-like 0.0654
Family PA2201 N-terminal domain-like 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_005303496.1.43483
Sequence length 182
Comment MULTISPECIES: protein syd [Aeromonas]; AA=GCF_000708085.1; RF=na; TAX=196024; STAX=196024; NAME=Aeromonas dhakensis; strain=SSU; AL=Contig; RT=Major
Sequence
MSDQVLSALEHFFLRWQRDGEVRRGLPLCEWEADWRSPCELDEPKEGRVAWRPHRRAEPA
DFTAMNEALELTLHPAAQALFGGWFSRPVPCLYKGLRLEFVLPWNEADLDLLKENLIGHL
LMLRKLKRSPSLFIATTRNEMTLVSLDNESGQVWLEWLDSGRRLVLAPSLPAFLERLETL
PQ
Download sequence
Identical sequences K1J8Z1
WP_005303496.1.43483 WP_005303496.1.45454 WP_005303496.1.78822 WP_005303496.1.96790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]