SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_005374115.1.70945 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_005374115.1.70945
Domain Number - Region: 28-71
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00863
Family PB1 domain 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_005374115.1.70945
Sequence length 81
Comment hypothetical protein [Vibrio alginolyticus]; AA=GCF_002119565.1; RF=na; TAX=663; STAX=663; NAME=Vibrio alginolyticus; strain=K06K5; AL=Complete Genome; RT=Major
Sequence
MRNQPKIVNLSSTSTTPEREAMKVLIQYTQAGKYRDQAWESLTLRSKGDMQAVTPSYAAQ
LIEQSKATLVMTEEQQIVIYP
Download sequence
Identical sequences WP_005374115.1.23210 WP_005374115.1.31008 WP_005374115.1.43162 WP_005374115.1.49504 WP_005374115.1.51667 WP_005374115.1.6150 WP_005374115.1.70945 WP_005374115.1.99004

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]