SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_005576655.1.71579 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_005576655.1.71579
Domain Number 1 Region: 13-68
Classification Level Classification E-value
Superfamily GAT-like domain 0.0000916
Family GAT domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_005576655.1.71579
Sequence length 70
Comment hypothetical protein [Natronobacterium gregoryi]; AA=GCF_000230715.2; RF=representative genome; TAX=797304; STAX=44930; NAME=Natronobacterium gregoryi SP2; strain=SP2; AL=Complete Genome; RT=Major
Sequence
MSERQPLSDLEVREQSLSKARDALAALQQIPAAGLDEAKHETVTEMVDNCRSLERALQNE
VEQMQGDPDE
Download sequence
Identical sequences L9YGD0
WP_005576655.1.6326 WP_005576655.1.71579 WP_005576655.1.8181

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]