SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_005682835.1.59392 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_005682835.1.59392
Domain Number - Region: 77-111
Classification Level Classification E-value
Superfamily GAT-like domain 0.0157
Family GAT domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_005682835.1.59392
Sequence length 147
Comment hypothetical protein [Bacteroides caccae]; AA=GCF_000169015.1; RF=na; TAX=411901; STAX=47678; NAME=Bacteroides caccae ATCC 43185; strain=ATCC 43185; AL=Contig; RT=Major
Sequence
MKVSLKFILATILLMLSYSIGGNAMDFASCVSKCESSCQLSESSSDIKSNSSLNSRAVGF
DKSSQSLTISDVELGFKSVSETSSNNYRLRRIIEVNDSLKDVMHKFSLLRENSLVLDQSK
SYYSDKDPHYSIISSDYYVFALRRILI
Download sequence
Identical sequences A0A174U4P0 A0A1Q6GUK7 I8USU5 R5U689
WP_005682835.1.29459 WP_005682835.1.32410 WP_005682835.1.45558 WP_005682835.1.59392 WP_005682835.1.70665

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]