SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_005726286.1.3957 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_005726286.1.3957
Domain Number 1 Region: 77-215
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 4.76e-46
Family Glutathione S-transferase (GST), C-terminal domain 0.00024
Further Details:      
 
Domain Number 2 Region: 1-77
Classification Level Classification E-value
Superfamily Thioredoxin-like 9.2e-19
Family Glutathione S-transferase (GST), N-terminal domain 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_005726286.1.3957
Sequence length 215
Comment glutaredoxin 2 [Pasteurella multocida]; AA=GCF_001670435.1; RF=na; TAX=44283; STAX=747; NAME=Pasteurella multocida subsp. multocida; strain=ATCC 11039; AL=Scaffold; RT=Major
Sequence
MELYVYDHCPYCVRAMMIFGLKNIPFKKHVLLNDDEETPIRLVGKKVVPILVKEDGTAMP
ESLDIVKYIDAHYGEAILQTAVRPEIEALLAEITSYSNYLLMPRFVKLDLAEFATQSAID
YFTKKKTDYVGDFTQHFNNTPTYLARLTQDLEKLSALVMGETSLNQHLSFEDILVFPLLR
NLTCVKGLRFPARLEKYIKRLSELSKVELYTSQAI
Download sequence
Identical sequences A0A1D2NTA7 A0A2K2YZH9 Q9CNB4
gi|15602383|ref|NP_245455.1| 272843.PM0518 WP_005726286.1.11014 WP_005726286.1.11214 WP_005726286.1.11947 WP_005726286.1.12156 WP_005726286.1.12311 WP_005726286.1.14908 WP_005726286.1.15732 WP_005726286.1.19996 WP_005726286.1.24757 WP_005726286.1.27664 WP_005726286.1.28084 WP_005726286.1.35562 WP_005726286.1.36022 WP_005726286.1.3807 WP_005726286.1.38246 WP_005726286.1.3957 WP_005726286.1.40210 WP_005726286.1.40787 WP_005726286.1.41351 WP_005726286.1.41667 WP_005726286.1.42469 WP_005726286.1.43687 WP_005726286.1.45422 WP_005726286.1.4808 WP_005726286.1.52585 WP_005726286.1.52859 WP_005726286.1.53852 WP_005726286.1.55401 WP_005726286.1.58111 WP_005726286.1.58257 WP_005726286.1.60478 WP_005726286.1.61098 WP_005726286.1.6219 WP_005726286.1.62389 WP_005726286.1.6332 WP_005726286.1.63549 WP_005726286.1.66990 WP_005726286.1.70689 WP_005726286.1.72215 WP_005726286.1.78987 WP_005726286.1.79347 WP_005726286.1.81885 WP_005726286.1.8281 WP_005726286.1.83579 WP_005726286.1.88402 WP_005726286.1.89773 WP_005726286.1.90578 WP_005726286.1.92478 WP_005726286.1.93940 WP_005726286.1.95718 WP_005726286.1.9746 WP_005726286.1.9947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]