SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_006055698.1.94995 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_006055698.1.94995
Domain Number 1 Region: 253-344
Classification Level Classification E-value
Superfamily tRNA-intron endonuclease catalytic domain-like 1.19e-20
Family tRNA-intron endonuclease catalytic domain-like 0.00065
Further Details:      
 
Domain Number 2 Region: 10-73
Classification Level Classification E-value
Superfamily tRNA-intron endonuclease N-terminal domain-like 0.00000000000000334
Family tRNA-intron endonuclease N-terminal domain-like 0.0096
Further Details:      
 
Domain Number 3 Region: 180-249
Classification Level Classification E-value
Superfamily tRNA-intron endonuclease N-terminal domain-like 0.00000000000255
Family tRNA-intron endonuclease N-terminal domain-like 0.0069
Further Details:      
 
Domain Number 4 Region: 79-164
Classification Level Classification E-value
Superfamily tRNA-intron endonuclease catalytic domain-like 0.00000000000541
Family tRNA-intron endonuclease catalytic domain-like 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_006055698.1.94995
Sequence length 349
Comment tRNA splicing endonuclease [Halogeometricum borinquense]; AA=GCF_000172995.2; RF=representative genome; TAX=469382; STAX=60847; NAME=Halogeometricum borinquense DSM 11551; strain=PR 3; AL=Complete Genome; RT=Major
Sequence
MSSPGAFSNMDATLHDDVVRVGDDARQRFYDSRGYGRPLDGNRLELAPVEAAHLLSRGDL
DDIDGMEFREFLAETGAALAFVVYKDLRDRGFYLSPAREEWPGVSDADGIDFVVYPRGKG
PTDGDVEYRIRVIGERERVAAASLGDVVLAVVDEDGDLTYFDTDDDPDVGGTDDYIPPEG
LDADLLSDRVVCYESPDEVYENGFYGQRLFGRNAEEGPLQLSLIEGAYLARRGVIDVDDE
EVVALARDVEGDRFDRRLKTYAALRDAGSVPKSGFKFGADFRVYTDFETVSSLSHSADLV
RVVTPDHAFFPRDLSLDVRLAGGVRKRMVFALTDANDGIDWLSVARLTP
Download sequence
Identical sequences E4NTH0
WP_006055698.1.71935 WP_006055698.1.94995 gi|313125090|ref|YP_004035354.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]