SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_006071685.1.83143 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_006071685.1.83143
Domain Number - Region: 27-90
Classification Level Classification E-value
Superfamily FAD-dependent thiol oxidase 0.00889
Family FAD-dependent thiol oxidase 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_006071685.1.83143
Sequence length 91
Comment MULTISPECIES: hypothetical protein [Vibrio]; AA=GCF_000181535.1; RF=na; TAX=391591; STAX=62153; NAME=Vibrio shilonii AK1; strain=AK1; AL=Contig; RT=Major
Sequence
MTKQHQCEQMPEEVQVYYTDHYTTEEQWFLFVSETATEMDLELSHELNEVGELLWQTAFN
IIHCPYCGLKFEKTTQKVTAHFHKAVNYKLI
Download sequence
Identical sequences A0A1P8MLU8 A0A2J7FJ73 A6D1K9
WP_006071685.1.101317 WP_006071685.1.266 WP_006071685.1.27450 WP_006071685.1.28858 WP_006071685.1.32528 WP_006071685.1.50290 WP_006071685.1.5980 WP_006071685.1.72707 WP_006071685.1.763 WP_006071685.1.83143 WP_006071685.1.93749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]