SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_006196534.1.7687 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_006196534.1.7687
Domain Number 1 Region: 42-146
Classification Level Classification E-value
Superfamily Oxygen-evolving enhancer protein 3, 2.35e-20
Family Oxygen-evolving enhancer protein 3, 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_006196534.1.7687
Sequence length 155
Comment photosystem II protein PsbQ [Nodularia spumigena]; AA=GCF_000340565.2; RF=representative genome; TAX=313624; STAX=70799; NAME=Nodularia spumigena CCY9414; strain=CCY9414; AL=Chromosome; RT=Major
Sequence
MARQRSIFSLILVLLATLLISCGGPSATVAPPTYTATQLERIGEYVPKIQAVRDRADELR
TLINKKDWIDVSNFIHGPMTEARSSMTYIIPNLVPSVQPVARQKNRDLLNDLVKIDQAAV
QSDTQLALTSYQKAMEDIDKFFQLLPDTSTQPEVS
Download sequence
Identical sequences A0ZFM6
WP_006196534.1.7687 WP_006196534.1.86392

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]