SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_006211330.1.48776 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_006211330.1.48776
Domain Number - Region: 27-97
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 0.00879
Family Retrovirus capsid protein C-terminal domain 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_006211330.1.48776
Sequence length 102
Comment MULTISPECIES: flagellar hook-basal body complex protein FliE [Paenibacillus]; AA=GCF_001633025.1; RF=na; TAX=59843; STAX=59843; NAME=Paenibacillus glucanolyticus; strain=SLM1; AL=Contig; RT=Major
Sequence
MIQNAMFSVQGVQPLQLQEQVKNGATPSESIRDFGSYLNEALNSVSAQEQNAHMMTDKLM
IGQVNVDQAMISAQQALLSIQLTTQVRNKVVEAYQEIMRTQI
Download sequence
Identical sequences A0A163EDB7 W4ATD9
WP_006211330.1.18433 WP_006211330.1.4269 WP_006211330.1.48776 WP_006211330.1.50844

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]