SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_006581857.1.74595 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_006581857.1.74595
Domain Number - Region: 32-55
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0837
Family Tachycitin 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_006581857.1.74595
Sequence length 166
Comment MULTISPECIES: N-6-adenine-methyltransferase [Acinetobacter calcoaceticus/baumannii complex]; AA=GCF_000588335.1; RF=na; TAX=1310761; STAX=1310761; NAME=Acinetobacter sp. 88816; strain=88816; AL=Contig; RT=Major
Sequence
MNTMAQSKLFGLAENRTDVWSTPQDFFEKLDRVFNFDLDVCALPENAKCERYFTPEIDGL
KQEWSGTCWMNPPYGCEIVDWIAKAAETASKGHTVVALVPVRTDARWFQDYCLGREIHFI
RGRLKFGGSSSNAPFGCCVVVFRPSLKDVQWIVTETDFRKAESKEG
Download sequence
Identical sequences WP_006581857.1.14433 WP_006581857.1.74595

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]