SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_007404121.1.53903 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_007404121.1.53903
Domain Number - Region: 54-87
Classification Level Classification E-value
Superfamily Trimerization domain of TRAF 0.034
Family Trimerization domain of TRAF 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_007404121.1.53903
Sequence length 95
Comment MULTISPECIES: hypothetical protein [Sphingomonas]; AA=GCF_000739895.2; RF=representative genome; TAX=1219050; STAX=13689; NAME=Sphingomonas paucimobilis NBRC 13935; strain=NBRC 13935; AL=Contig; RT=Major
Sequence
MHDFAILIPLFGISCGMVAIIGGVVIKPWFAYREKRLATEASMVAEKAAQYAAQTERLER
RVRVLERIITDRGLALSDEIDGLRAFDAAPTRIEH
Download sequence
Identical sequences A0A0C9NCS6
WP_007404121.1.14240 WP_007404121.1.53903 WP_007404121.1.54864

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]