SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_007582956.1.38198 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_007582956.1.38198
Domain Number - Region: 44-104
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0137
Family Anti-platelet protein 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_007582956.1.38198
Sequence length 119
Comment MULTISPECIES: hypothetical protein [Burkholderiaceae]; AA=GCF_000265115.1; RF=na; TAX=1171375; STAX=311230; NAME=Paraburkholderia terrae BS001; strain=BS001; AL=Contig; RT=Major
Sequence
MRLTILINGSDPTVNHDYAVLWLDTDEHRWSREAHDGIDLPPWGELHDENGVTKLCAPSA
EAPLCTLNGLHVDGRQRVSSAQGSAAWSSDRTHAPMNGYWRLQAVDRLPVNAEHSVFGR
Download sequence
Identical sequences A0A1H6IX96 A0A235GNL3 A0A244DFA3 A0A2C9APH2 I5CVC2
WP_007582956.1.10406 WP_007582956.1.12721 WP_007582956.1.14847 WP_007582956.1.25358 WP_007582956.1.38198 WP_007582956.1.50346 WP_007582956.1.57484 WP_007582956.1.80201 WP_007582956.1.8162 WP_007582956.1.87037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]