SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_007725281.1.83547 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_007725281.1.83547
Domain Number - Region: 54-88
Classification Level Classification E-value
Superfamily BRK domain-like 0.0575
Family BRK domain-like 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_007725281.1.83547
Sequence length 207
Comment MULTISPECIES: transcriptional regulator (anti-sigma factor) [Brevibacillus]; AA=GCF_001039275.1; RF=na; TAX=1393; STAX=1393; NAME=Brevibacillus brevis; strain=DZQ7; AL=Contig; RT=Major
Sequence
MECRDMICLIHEYLDGDTDELANLQLQTHIKSCVSCRQHMHELQRAIAFVQSASHIHVSS
DFTARVLAQLPAPTKANLLSGWLRNHPFLTAAAVFLFLMTGSVFNSWFDRDDTLQVSSAN
LDKLKIDRERNVVVVPAGTNIDGDLVVRNGNVDVRGHVTGNVVAIEGKVFVASTAQVVGN
TESIEAIVDWIWYEVKNIGNDLLPILP
Download sequence
Identical sequences A0A0J6B9C0 J2G631
WP_007725281.1.34404 WP_007725281.1.57305 WP_007725281.1.83547

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]