SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_007895234.1.98853 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_007895234.1.98853
Domain Number - Region: 35-55
Classification Level Classification E-value
Superfamily Cysteine-rich DNA binding domain, (DM domain) 0.0222
Family Cysteine-rich DNA binding domain, (DM domain) 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_007895234.1.98853
Sequence length 68
Comment hypothetical protein [Cronobacter sakazakii]; AA=GCF_001971415.1; RF=na; TAX=28141; STAX=28141; NAME=Cronobacter sakazakii; strain=1249; AL=Scaffold; RT=Major
Sequence
MSQITHYSLFLRQASRTRGKRQYCRDSTLSATPSHSRVHYCSFRKCLCAFCQYYRLARWG
KINDKRDN
Download sequence
Identical sequences A0A0F6VSC5
WP_007895234.1.17179 WP_007895234.1.22032 WP_007895234.1.23247 WP_007895234.1.25078 WP_007895234.1.29215 WP_007895234.1.39163 WP_007895234.1.44053 WP_007895234.1.48540 WP_007895234.1.69840 WP_007895234.1.72434 WP_007895234.1.82482 WP_007895234.1.8619 WP_007895234.1.86449 WP_007895234.1.86965 WP_007895234.1.89683 WP_007895234.1.93581 WP_007895234.1.93704 WP_007895234.1.98221 WP_007895234.1.98853

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]