SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_007970654.1.52489 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_007970654.1.52489
Domain Number - Region: 109-134
Classification Level Classification E-value
Superfamily Small-conductance potassium channel 0.0732
Family Small-conductance potassium channel 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_007970654.1.52489
Sequence length 154
Comment hypothetical protein [Xanthomonas fuscans]; AA=GCF_001610795.1; RF=na; TAX=76802; STAX=366648; NAME=Xanthomonas fuscans subsp. aurantifolii; strain=FDC 1559; AL=Complete Genome; RT=Major
Sequence
MSASALQTLRELYPQRYALRPEEVAHVLRGQSTRGVVQRVREGMQSGRYPGARKIDGLIQ
MPLEALAEILDPAPAPQPVVPTITPSISRRRSSIGPRLSFVRSAGFWEQVMGAIGEQNLA
DELGEAAANVLRELRYEEARARANWEFEALRAEP
Download sequence
Identical sequences D4T319
WP_007970654.1.35849 WP_007970654.1.52489

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]