SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_007977850.1.47698 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_007977850.1.47698
Domain Number - Region: 38-77
Classification Level Classification E-value
Superfamily PA2201 N-terminal domain-like 0.0235
Family PA2201 N-terminal domain-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_007977850.1.47698
Sequence length 89
Comment hypothetical protein [Haladaptatus paucihalophilus]; AA=GCF_900142335.1; RF=na; TAX=797209; STAX=367189; NAME=Haladaptatus paucihalophilus DX253; strain=DX253; AL=Contig; RT=Major
Sequence
MHQSICPWCAENIDHPTDCVRIAPPDRRPPEHRPTVNRWYLHADCAAEWREFVGHLRTLA
GRGAFRTLVEGPLSGDVNEMLEWELADTS
Download sequence
Identical sequences E7QQS1
WP_007977850.1.29813 WP_007977850.1.40868 WP_007977850.1.47698

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]