SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_008361366.1.67245 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_008361366.1.67245
Domain Number - Region: 6-63
Classification Level Classification E-value
Superfamily HR1 repeat 0.0199
Family HR1 repeat 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_008361366.1.67245
Sequence length 64
Comment acid-soluble spore protein [Bacillus xiamenensis]; AA=GCF_000300535.1; RF=na; TAX=1178537; STAX=1178537; NAME=Bacillus xiamenensis; strain=HYC-10; AL=Contig; RT=Major
Sequence
MANRNQLLVPGVEQALDQFKYEIAQEFGVNLGSDTVARANGSVGGEITKRLVQQAQSQMG
NSTK
Download sequence
Identical sequences K2NZ37
WP_008361366.1.21454 WP_008361366.1.67245

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]