SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_008392585.1.38793 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_008392585.1.38793
Domain Number - Region: 196-244
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0141
Family Rad21/Rec8-like 0.031
Further Details:      
 
Domain Number - Region: 39-157
Classification Level Classification E-value
Superfamily VPS9 domain 0.0654
Family VPS9 domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_008392585.1.38793
Sequence length 246
Comment MULTISPECIES: chromosome segregation and condensation protein ScpA [Clostridiales]; AA=GCF_001405715.1; RF=na; TAX=649756; STAX=649756; NAME=Anaerostipes hadrus; strain=2789STDY5608868; AL=Contig; RT=Major
Sequence
MGIDIKVNAFEGPLDLLLHLIEKNKVDIYDIPISEITSQYLDYIRSMEEEDLDVMSDFLV
MAATLLKIKAKMLLPVKEEEEEEGDPREELVRRLIEYKIYKYASLQLKEREMMAEKSFFR
SPDIPPQVLAYREEIDPVQMLSEVTLQRISEVFQFVMRKRQDKLDPIRSEFGEIKQEEIK
LEDKITEVYNYIIQYKEVNFYDLLNEQETKEAVIVTFLAVLELMKTGKIYVQQENIEDDI
FIRALE
Download sequence
Identical sequences A0A1Q6N2Z1 B0NYU0 D4MZK1 R5YYQ3
gi|479159772|ref|YP_007789041.1| WP_008392585.1.33200 WP_008392585.1.34949 WP_008392585.1.38793 WP_008392585.1.48195 WP_008392585.1.93725 WP_008392585.1.96038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]