SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_008467558.1.95979 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_008467558.1.95979
Domain Number - Region: 19-69
Classification Level Classification E-value
Superfamily FAD-dependent thiol oxidase 0.0889
Family FAD-dependent thiol oxidase 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_008467558.1.95979
Sequence length 132
Comment MULTISPECIES: hypothetical protein [Flavobacterium]; AA=GCF_001705175.1; RF=na; TAX=986; STAX=986; NAME=Flavobacterium johnsoniae; strain=GSE09; AL=Complete Genome; RT=Major
Sequence
MTLATQIVWLFVLAIPIACISWTVTHEEIFREPHEWCVRHSKNDKYILSRKFFYLLTCEY
CFSHYVTIAFLIICGYKLLLNDWRGYILAGFSLVFMANVYMSLFALLRQAIKKEKVEIEK
IESETDTENSKN
Download sequence
Identical sequences J0RWK8
WP_008467558.1.57033 WP_008467558.1.95979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]