SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_008502544.1.2052 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_008502544.1.2052
Domain Number 1 Region: 63-158
Classification Level Classification E-value
Superfamily TPR-like 9.05e-16
Family Tetratricopeptide repeat (TPR) 0.01
Further Details:      
 
Weak hits

Sequence:  WP_008502544.1.2052
Domain Number - Region: 35-53
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00139
Family Antifungal peptide scarabaecin 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_008502544.1.2052
Sequence length 175
Comment MULTISPECIES: hypothetical protein [Enterobacter cloacae complex]; AA=GCF_000956965.1; RF=na; TAX=1870938; STAX=1870938; NAME=Enterobacter cloacae complex sp. 35618; strain=35618; AL=Contig; RT=Major
Sequence
MRTTSFRLIPVLIFSLLSPLALAMGNNSTESKTPDCPSGQVYDSATQKCVPDKSSSLSDQ
DKTNYAYHLAKKGEYQAALNLLDSLKNGNTAEAWNYRGFATRKLGRTDEGIGYYQRALAI
APDYAKAREYLGEAWMVKGRPDLAKEQLKVIAGICGQSCEEYRDLQAAINGHPES
Download sequence
Identical sequences A0A156DK79 A0A1S2A4R5
WP_008502544.1.101043 WP_008502544.1.17804 WP_008502544.1.18660 WP_008502544.1.2049 WP_008502544.1.2052 WP_008502544.1.26028 WP_008502544.1.26596 WP_008502544.1.28077 WP_008502544.1.33611 WP_008502544.1.34807 WP_008502544.1.47648 WP_008502544.1.49454 WP_008502544.1.58439 WP_008502544.1.61137 WP_008502544.1.65273 WP_008502544.1.65377 WP_008502544.1.69567 WP_008502544.1.69799 WP_008502544.1.69838 WP_008502544.1.75345 WP_008502544.1.77209 WP_008502544.1.80110 WP_008502544.1.80727 WP_008502544.1.83562 WP_008502544.1.88432 WP_008502544.1.98707

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]