SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_008541232.1.86776 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_008541232.1.86776
Domain Number - Region: 133-188
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000432
Family Pan module (APPLE domain) 0.03
Further Details:      
 
Domain Number - Region: 51-89
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000746
Family Pan module (APPLE domain) 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_008541232.1.86776
Sequence length 191
Comment hypothetical protein [Bradyrhizobium sp. CCGE-LA001]; AA=GCF_000296215.2; RF=na; TAX=1223566; STAX=1223566; NAME=Bradyrhizobium sp. CCGE-LA001; strain=CCGE-LA001; AL=Complete Genome; RT=Major
Sequence
MGKGRLRGVIAKVLASVVACAALLSLAVASVPARAQTAFDRPGGDYFSTPVTSGDPEDCA
LLCERDRRCRSWSFNYPDVEGGSAVCWLKNTVPARVPGSCCISGVRGAGVIEPRVEGVET
SIDRPGGDLRNFELKSGDGEDACKAACTADNKCRAFTYARPGYTGREARCFLKKEIKPPR
RKAGFTSGVVR
Download sequence
Identical sequences A0A109QD69
WP_008541232.1.86776

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]