SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_008787595.1.65802 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_008787595.1.65802
Domain Number - Region: 21-46
Classification Level Classification E-value
Superfamily ARID-like 0.00593
Family ARID domain 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_008787595.1.65802
Sequence length 109
Comment MULTISPECIES: DNA-directed RNA polymerase subunit delta [Coprobacillus]; AA=GCF_000186525.1; RF=na; TAX=469596; STAX=469596; NAME=Coprobacillus sp. 29_1; strain=29_1; AL=Scaffold; RT=Major
Sequence
MIDYKQSSMVDIAFDLMKKKKKPVDFYKLWQEVSEIKGFSEADKDENESLFYTNITLDGR
LITVGENHWDLRSRHKFDEVHIDMNDIYADEEETPEEEEDDGLVEDDYN
Download sequence
Identical sequences E7G6T6
WP_008787595.1.31879 WP_008787595.1.65802

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]