SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_009002946.1.83557 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_009002946.1.83557
Domain Number - Region: 10-57
Classification Level Classification E-value
Superfamily GAT-like domain 0.0479
Family GAT domain 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_009002946.1.83557
Sequence length 85
Comment MULTISPECIES: spore coat protein [Clostridiales]; AA=GCF_000190355.1; RF=na; TAX=556261; STAX=556261; NAME=Clostridium sp. D5; strain=D5; AL=Scaffold; RT=Major
Sequence
MNEKTMVSDALVGVNGELKMFGDMIPQTENQELKQCLKQFRNSCEMSQEKLYQVAREKSY
YVPAAKATQQEVEHVKSVLTQPKTF
Download sequence
Identical sequences F0YXL4
WP_009002946.1.83557 WP_009002946.1.8845

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]