SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_009111505.1.95200 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_009111505.1.95200
Domain Number - Region: 142-173
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0732
Family Second domain of FERM 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_009111505.1.95200
Sequence length 204
Comment membrane protein [Brenneria sp. EniD312]; AA=GCF_000225565.1; RF=na; TAX=598467; STAX=598467; NAME=Brenneria sp. EniD312; strain=EniD312; AL=Chromosome; RT=Major
Sequence
MDNVIATEKLSHTLLEDVLAIIIGTLMVSFGVILLRQAGALTGGTAGLAFLLHYLTQVSF
GVAFFLINLPFYYLSIRRMGWKFTVKTFCAVALVSAFSSLHPLFVHFDHLNPFYAAVFGN
IIMGLGFIVLFRHKTSLGGVNILALYLQDKYGIRAGKLQMGVDVVIVLASLFVVSIPMLI
ASILGATILNLIIAMNHRPGRYAV
Download sequence
Identical sequences G7LJP4
WP_009111505.1.95200

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]