SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_009249961.1.2903 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_009249961.1.2903
Domain Number 1 Region: 3-90
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 3.57e-24
Family DNA primase zinc finger 0.0018
Further Details:      
 
Weak hits

Sequence:  WP_009249961.1.2903
Domain Number - Region: 123-162
Classification Level Classification E-value
Superfamily eEF1-gamma domain 0.0288
Family eEF1-gamma domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_009249961.1.2903
Sequence length 215
Comment DNA primase [Lachnospiraceae bacterium 3_1_57FAA_CT1]; AA=GCF_000218405.2; RF=na; TAX=658086; STAX=658086; NAME=Lachnospiraceae bacterium 3_1_57FAA_CT1; strain=3_1_57FAA_CT1; AL=Scaffold; RT=Major
Sequence
MNVFEAVKQSVTTRQAAEHYGVRVGRTGMCVCPFHDDKNPSMKVDRRFHCFGCQADGDVI
DFVSRLENVSPKEAALMLAQDFSIPYEDKEPPGRSRPKRKPRQESPEQQFKSMERYCFRV
LSDYHNLLRRWKRDYAHKTPNEEWHPFFVEALQKQSHVEYLLDVLLFSDMRKRAALIASY
GKEVRNLERRMADLAARTAAGRDGHHRSRTPAPER
Download sequence
Identical sequences F7K2D3
WP_009249961.1.2903

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]