SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_009446532.1.90673 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_009446532.1.90673
Domain Number - Region: 16-70
Classification Level Classification E-value
Superfamily p53-like transcription factors 0.00335
Family Rel/Dorsal transcription factors, DNA-binding domain 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_009446532.1.90673
Sequence length 72
Comment hypothetical protein [Lachnospiraceae bacterium oral taxon 082]; AA=GCF_000242315.1; RF=na; TAX=861454; STAX=712976; NAME=Lachnospiraceae bacterium oral taxon 082 str. F0431; strain=F0431; AL=Scaffold; RT=Major
Sequence
MSLKEEFMKITTYEEWDRRRYEFKGLDAGDMEVRKHLNELYPTADISGYEKGIVKDYFYK
IDEITGKRVKIF
Download sequence
Identical sequences H1LXB5
WP_009446532.1.90673

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]