SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_009461377.1.3291 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_009461377.1.3291
Domain Number 1 Region: 15-198
Classification Level Classification E-value
Superfamily Archaeal IMP cyclohydrolase PurO 5.1e-22
Family Archaeal IMP cyclohydrolase PurO 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_009461377.1.3291
Sequence length 237
Comment inosine monophosphate cyclohydrolase [Lachnospiraceae bacterium 2_1_46FAA]; AA=GCF_000209385.2; RF=na; TAX=742723; STAX=742723; NAME=Lachnospiraceae bacterium 2_1_46FAA; strain=2_1_46FAA; AL=Scaffold; RT=Major
Sequence
MEMLSIEKELQENAYPGRGIIIGRTPDGKKAVTAYFIMGRSENSRNRVFVEEGRGIRTQA
FDPSKLTDPSLIIYAPVRVLGNKTIVTNGDQTDTIYEGMDKQLTFEQSLRCREFEPDAPN
YTPRISGVLHIENGKYSYAMSILKSDNGNPEACNRYTFAYENAIAGEGHFIHTYKCDGNP
LPSFEGEPKRVAMSDDMEAFAEMLWNSLNEDNKVSLFVRYIDIETGKEETKIVNKNK
Download sequence
Identical sequences F3BB70
WP_009461377.1.3291

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]