SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_009594713.1.35877 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_009594713.1.35877
Domain Number - Region: 27-97
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 0.0275
Family Retrovirus capsid protein C-terminal domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_009594713.1.35877
Sequence length 102
Comment MULTISPECIES: flagellar hook-basal body complex protein FliE [Paenibacillus]; AA=GCF_000024685.1; RF=na; TAX=481743; STAX=481743; NAME=Paenibacillus sp. Y412MC10; strain=Y412MC10; AL=Complete Genome; RT=Major
Sequence
MIQNAMFSVQGVQPLQMQEQVKNGATPSESIRDFGSYLNEALNSVAAQEQNAHVMSDKLM
IGQVNVDQAMISAQQALLSIQLTTQVRNKVVEAYQEIMRTQI
Download sequence
Identical sequences A0A1H7FKU5 A0A2A5LNH0 D3E6U6 F3MGS4
481743.GYMC10_4192 gi|261407985|ref|YP_003244226.1| WP_009594713.1.24093 WP_009594713.1.35877 WP_009594713.1.3965 WP_009594713.1.52352

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]