SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_009879854.1.42217 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_009879854.1.42217
Domain Number 1 Region: 38-170
Classification Level Classification E-value
Superfamily TNF-like 7.04e-21
Family TNF-like 0.005
Further Details:      
 
Weak hits

Sequence:  WP_009879854.1.42217
Domain Number - Region: 5-32
Classification Level Classification E-value
Superfamily Duffy binding domain-like 0.051
Family Duffy binding domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_009879854.1.42217
Sequence length 178
Comment MULTISPECIES: hypothetical protein [Bacillus cereus group]; AA=GCF_002147005.1; RF=na; TAX=180874; STAX=1428; NAME=Bacillus thuringiensis serovar pondicheriensis; strain=BGSC 4BA1; AL=Contig; RT=Major
Sequence
MSCYYYCKHCKEYKKKQHNCCKNNSKCNDNKDSLVRASAFRARNTVNQPVPANTFVKVLF
QNEQFDLANEYNPATSIFIPKTRGVYSIIGTIGFFPNNSNSDYRARVEIRVNGNAAIAID
NDFFGTINFGNVVSVSTIIQLNEGDQVEVYAQSSIDGVLSTSEDGSHFEAARFPSPTE
Download sequence
Identical sequences A0A0B5NHB4 A0A1N7UQ53 A0A2B6C8U4 B7JMQ8 Q6HJ36
gi|218903472|ref|YP_002451306.1| WP_009879854.1.100059 WP_009879854.1.13233 WP_009879854.1.15163 WP_009879854.1.16013 WP_009879854.1.23615 WP_009879854.1.29804 WP_009879854.1.40550 WP_009879854.1.42217 WP_009879854.1.43104 WP_009879854.1.45919 WP_009879854.1.56580 WP_009879854.1.56959 WP_009879854.1.60841 WP_009879854.1.63137 WP_009879854.1.7545 WP_009879854.1.80439 WP_009879854.1.90155 WP_009879854.1.90883 WP_009879854.1.94373 YP_036440.1.62562 gi|49479992|ref|YP_036440.1| 281309.BT9727_2113 405535.BCAH820_2356

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]