SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_009886793.1.98901 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_009886793.1.98901
Domain Number 1 Region: 82-169
Classification Level Classification E-value
Superfamily eIF2alpha middle domain-like 1.18e-20
Family eIF2alpha middle domain-like 0.0022
Further Details:      
 
Domain Number 2 Region: 170-248
Classification Level Classification E-value
Superfamily eIF-2-alpha, C-terminal domain 2.09e-20
Family eIF-2-alpha, C-terminal domain 0.0023
Further Details:      
 
Domain Number 3 Region: 3-85
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.29e-19
Family Cold shock DNA-binding domain-like 0.00084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_009886793.1.98901
Sequence length 253
Comment translation initiation factor IF-2 subunit alpha [Ferroplasma acidarmanus]; AA=GCF_000152265.2; RF=representative genome; TAX=333146; STAX=97393; NAME=Ferroplasma acidarmanus fer1; strain=fer1; AL=Complete Genome; RT=Major
Sequence
MSRDMPEPGDLVVVTIKEVQNYGAIVQLDEYPGVSGFIHIAEVATGWIKHIKDFVRVNQR
TVCKVLNVDSNRRHVDLSLKRVNEHQKREKIEEWKNDQKSEKLLEIVAKEANISDKAITK
NMEDYLVSEYGSAYDAFFEAASNKEFMSDKNEPWKDAFIKVAKENISIPMVKIGGEIDMY
SLASNGIELIREALDVDSGNNIEITYAGSPKYRISIVDEDYKSAEEKLKNVLEKISTACK
KYSISYSFTRDEQ
Download sequence
Identical sequences S0APR6
WP_009886793.1.98901 gi|518652123|ref|YP_008141643.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]