SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_009988767.1.43719 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_009988767.1.43719
Domain Number 1 Region: 81-177
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.07e-20
Family Cold shock DNA-binding domain-like 0.00036
Further Details:      
 
Domain Number 2 Region: 1-77
Classification Level Classification E-value
Superfamily N-terminal, heterodimerisation domain of RBP7 (RpoE) 2.86e-20
Family N-terminal, heterodimerisation domain of RBP7 (RpoE) 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_009988767.1.43719
Sequence length 180
Comment DNA-directed RNA polymerase [Sulfolobus solfataricus]; AA=GCF_900079115.1; RF=representative genome; TAX=2287; STAX=2287; NAME=Sulfolobus solfataricus; strain=P1; AL=Complete Genome; RT=Major
Sequence
MYKLIKARSIVRIPPNEFGKPLNEIALNELRQQYQEKILKDLGLVLAILNVKTSEEGILV
FGDGATYHEVEFDMITYVPVVQEVVEGEVLQVDNYGIFVNLGPMDGLVHISQITDDTLKY
DNVRGIIFGEKSKKVIQKGDKVRARVISVASTVTGRLPRIALTMRQPYLGKLEWITQTKK
Download sequence
Identical sequences A0A0E3MBZ4 D0KSA6 Q980A3
gi|384433868|ref|YP_005643226.1| gi|15897347|ref|NP_341952.1| 273057.SSO0415 WP_009988767.1.14611 WP_009988767.1.22626 WP_009988767.1.43719 WP_009988767.1.57434 WP_009988767.1.66040 WP_009988767.1.8449 WP_009988767.1.93834 2pmz_E 2pmz_T 3hkz_E 3hkz_Q

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]