SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_009990389.1.66040 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_009990389.1.66040
Domain Number 1 Region: 10-99
Classification Level Classification E-value
Superfamily SRP19 2.09e-17
Family SRP19 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_009990389.1.66040
Sequence length 102
Comment signal recognition particle [Sulfolobus solfataricus]; AA=GCF_000968435.1; RF=na; TAX=2287; STAX=2287; NAME=Sulfolobus solfataricus; strain=SULA; AL=Complete Genome; RT=Major
Sequence
MSLRDLKEENRIVIWPSYFFSPTRSKGRRLARIPYKIKTEELVSTLRELGLDPIVIENKK
YPRDRKINFLIAVKKVKSKNYTLKIIHNALMGTRQTNPNKSN
Download sequence
Identical sequences A0A0E3K8K9 D0KRL1 Q980W2
WP_009990389.1.14611 WP_009990389.1.22626 WP_009990389.1.43719 WP_009990389.1.57434 WP_009990389.1.66040 WP_009990389.1.8449 WP_009990389.1.93834 gi|15897115|ref|NP_341720.1| gi|384433623|ref|YP_005642981.1| 273057.SSO0165

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]