SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_010229870.1.89087 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_010229870.1.89087
Domain Number 1 Region: 294-487
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.16e-44
Family Ribonuclease PH domain 1-like 0.0000259
Further Details:      
 
Domain Number 2 Region: 13-143
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 5.06e-41
Family Ribonuclease PH domain 1-like 0.0000735
Further Details:      
 
Domain Number 3 Region: 449-546
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.02e-28
Family Ribonuclease PH domain 2-like 0.00013
Further Details:      
 
Domain Number 4 Region: 148-230
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 9.29e-25
Family Ribonuclease PH domain 2-like 0.0013
Further Details:      
 
Domain Number 5 Region: 553-639
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 5.31e-20
Family Eukaryotic type KH-domain (KH-domain type I) 0.002
Further Details:      
 
Domain Number 6 Region: 619-692
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 6.39e-18
Family Cold shock DNA-binding domain-like 0.00068
Further Details:      
 
Domain Number 7 Region: 238-319
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.00000000549
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_010229870.1.89087
Sequence length 693
Comment polyribonucleotide nucleotidyltransferase [Chlamydia muridarum]; AA=GCF_000700905.1; RF=na; TAX=83560; STAX=83560; NAME=Chlamydia muridarum; strain=Var004; AL=Contig; RT=Major
Sequence
MAFETFSVALDKDKTLIFETGKIARQANGAVLVKMNETWVFSSACAASLSEAVDFLPFRV
DYQEKFSSAGKTSGGFLKREGRPSEKEILISRLIDRSLRPSFPNRLMQDIQVLSYVWSYD
GKTLPDPLAICGASAALAISEVPQNCIVAGVRVGLVEGKWVVNPTKDELDASKLDLVMAG
TASAVLMIEGHCDFLTEEQVLEAIAFGQKYIAKICDAIEAWQKAIGKEKQLSAVLDLPED
VQNVVSNFIREKFEKALSFRDRDALEQVSKELEESVVANLVQEESDFSLLNVKAAFKNAK
SNQMRALIRDLGIRVDGRSTTEIRPISIEVSFLPRTHGSCLFTRGETQSVAVCTLGGESM
AQRFEDLNGDGAARFYLQYFFPPFSVGEVGRIGSPGRREIGHGKLAEKALSHVLPEASRF
PYTVRVESNITESNGSSSMASVCGGCLSLMDAGVPIKAPVAGIAMGLILDQDKAIVLSDI
SGIEDHLGDMDFKVAGTEEGITAFQMDIKVEGITHEIMEQALAQAKQGRSHILNLMTQVM
SSPNDSVSRYAPRIETMQINTSKIATVIGPGGKQIRQIIERSGAQVDINDNGLINISANT
QESIDKAKELIEGLTGEVEVGKIYNGRVTSVVAFGAFVEVLPGKEGLCHISELSKQKVDN
VADFVKEGDRLAVKLLSINEKGQLKLSHKATLE
Download sequence
Identical sequences A0A069ZQV7 Q9PL77
243161.TC0230 gi|15834850|ref|NP_296609.1| WP_010229870.1.18971 WP_010229870.1.19393 WP_010229870.1.21797 WP_010229870.1.40339 WP_010229870.1.40903 WP_010229870.1.45721 WP_010229870.1.46238 WP_010229870.1.60880 WP_010229870.1.63773 WP_010229870.1.69188 WP_010229870.1.77803 WP_010229870.1.85209 WP_010229870.1.89087 WP_010229870.1.91588

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]