SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_010481866.1.67183 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_010481866.1.67183
Domain Number 1 Region: 1-64
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 0.0000000000000051
Family 7-Fe ferredoxin 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_010481866.1.67183
Sequence length 75
Comment MULTISPECIES: ferredoxin [Acaryochloris]; AA=GCF_000018105.1; RF=representative genome; TAX=329726; STAX=155978; NAME=Acaryochloris marina MBIC11017; strain=MBIC11017; AL=Complete Genome; RT=Major
Sequence
MAHTIVTDVCEGIADCVDACPVACIHEGPGKNVIGTDWYWIDFSTCIDCGICQQVCPVDG
AILAEERSDLQKTPS
Download sequence
Identical sequences B0C6H4
329726.AM1_1363 gi|158334537|ref|YP_001515709.1| WP_010481866.1.53659 WP_010481866.1.67183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]