SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_010821421.1.13021 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_010821421.1.13021
Domain Number - Region: 232-293
Classification Level Classification E-value
Superfamily Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain 0.0889
Family Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_010821421.1.13021
Sequence length 316
Comment MULTISPECIES: hypothetical protein [Bacilli]; AA=GCF_001053495.1; RF=na; TAX=1351; STAX=1351; NAME=Enterococcus faecalis; strain=135_EFLS; AL=Contig; RT=Major
Sequence
MEISEIAQTLYPFMGSEYVKPQDFLIALLDSVSNDDEATIFGFSDDNLRRFYNGTRPLTQ
EYAVRVAGKFNIDKCTTFIYERLIDDAPTVLKQQLIDKGVVIPKDTDVSEIVAHLLLDEI
TSIASQTKVKTKKAKPKLSELELASLRINTNGDFSYNDEVKKFFDDLPVPLDIRAEEMTY
VIALFSAYADADGYEVYEHTNDLPNSRLKDFKRQRRNYYKAESIRRGVRDNFTQEEGTEH
FEALKEDMYDGIEEVYEEDYDDGVERLKAVLQQSSVITLNGSILSFIPGLLQNSAKKGIC
HMLVNDGKIKWVTEDE
Download sequence
Identical sequences A0A2K3PXQ5
WP_010821421.1.13021 WP_010821421.1.15085 WP_010821421.1.19165 WP_010821421.1.20348 WP_010821421.1.21889 WP_010821421.1.23448 WP_010821421.1.25471 WP_010821421.1.32500 WP_010821421.1.32914 WP_010821421.1.35449 WP_010821421.1.44663 WP_010821421.1.50160 WP_010821421.1.64289 WP_010821421.1.81647 WP_010821421.1.8179 WP_010821421.1.85465 WP_010821421.1.97569

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]