SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_010873739.1.47586 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_010873739.1.47586
Domain Number 1 Region: 658-820
Classification Level Classification E-value
Superfamily Nucleotide cyclase 1.65e-45
Family GGDEF domain 0.00015
Further Details:      
 
Domain Number 2 Region: 359-488
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.93e-23
Family Heme-binding PAS domain 0.047
Further Details:      
 
Domain Number 3 Region: 246-365
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.19e-18
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.028
Further Details:      
 
Domain Number 4 Region: 516-616
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 4.33e-18
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.069
Further Details:      
 
Domain Number 5 Region: 104-227
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.51e-16
Family N-terminal PAS domain of Pas kinase 0.054
Further Details:      
 
Weak hits

Sequence:  WP_010873739.1.47586
Domain Number - Region: 51-101
Classification Level Classification E-value
Superfamily HAMP domain-like 0.000183
Family HAMP domain 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_010873739.1.47586
Sequence length 829
Comment sensor domain-containing diguanylate cyclase [Synechocystis sp. PCC 6803]; AA=GCF_001318385.1; RF=na; TAX=1148; STAX=1148; NAME=Synechocystis sp. PCC 6803; strain=PCC 6803 substr. GT-G; AL=Complete Genome; RT=Major
Sequence
MLQVLLVMAVLVFSALSLDFFGQLNNNVYLFLVLGIIIFLIPALTSLYIARLVIEPLRKL
VTTSQNLAQGTSHGTITQPVAIAEIQQLAKAINGMALRLQQSLAQTKEELQGSKELYRQV
VQSQTDFILRSQPDTTITFANDALCQALGLALPEVIGLQWLDFIVEEDLKIVLDKIACLT
PEQPQFINENQDKRAGGVLGYTQWVSRGIFNDKGQLIEIQSVGRDISALKETQLELRQSQ
KFIESIAEATPSLLYIYDHIKQANIYSNRSVAEFLGYSPEEIKTMGASLFTNICHPEDLP
RILAAIENCQKLRDGEILEIEYRVRDARQQWRWLLSRDLVFTRTETGQLWQTLGTAQDIT
QRKEAEIELEKIKTFLASIVENIPDMIFVKDAKTLRFLELNKAGESLIGYTKEEVLGKND
YELFPQERAEWFIQEDRQVLLSGEVQDIPMEVIQTCHEGIRILHTKKIPICDASGQAQYL
LGISADITDLLESQQRLQELARHIPGVIYQFRMRPDGTFHFPYASEGIRKIYGVSPEEVK
EDATPVFNVLHPDELPGVSRSIYESAANLTPWYYEYRVCFADGRVIWVLGYATPRRESDG
GTIWHGYIKDITDRKEEEYLLIKAKERAETAEQTLQKAQIRLERFNKKLSQLIDIDGLTK
IANRRCFNVRIKQEWRRLSRAQVPISLIMFDIDCFKNYNDRYGHPEGDLCLIRVAQAARK
AASRPADLVARFGGEEFAVLLPETDTKGAIMVAEKIIQAISQLAIAHEASPISGQITISL
GIGTQFPSKELISRTLIKQADMALYEAKRRGRNQYVVWTEELEGESSLS
Download sequence
Identical sequences Q55414
gi|383323456|ref|YP_005384310.1| gi|383326625|ref|YP_005387479.1| gi|16331713|ref|NP_442441.1| 1148.slr0829 gi|383492509|ref|YP_005410186.1| WP_010873739.1.11876 WP_010873739.1.1889 WP_010873739.1.18904 WP_010873739.1.33690 WP_010873739.1.35395 WP_010873739.1.47586 WP_010873739.1.99424 gi|16331713|ref|NP_442441.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]