SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_010873989.1.47586 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_010873989.1.47586
Domain Number 1 Region: 62-232,326-433
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.31e-18
Family FAD/NAD-linked reductases, N-terminal and central domains 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_010873989.1.47586
Sequence length 522
Comment hypothetical protein [Synechocystis sp. PCC 6803]; AA=GCF_001318385.1; RF=na; TAX=1148; STAX=1148; NAME=Synechocystis sp. PCC 6803; strain=PCC 6803 substr. GT-G; AL=Complete Genome; RT=Major
Sequence
MNYATTPTAFVESKLNSMPGDALGYLRRLDQRWQALCQGDLPPIAEVAQKVNTNLGEADF
DAVICGGTLGILLAASLQIRGWQVVVIERGKLQGRAQEWNISRQELQTFVELELLTSEEL
ETAIASEYNPGRIAFHGGQEFWIKNVLNVGIDPIYLLEKLKQKFLQAGGKLLEHSAFQKA
IIHSDGVAISYQHDGENQVERKLTSRLLIDAMGHGSPLVNQARQGEIPDGVCLVVGSCAQ
GYSDNETGDLIATTTGITNHCQYFWEAFPARDGRTTYLFTYVDVHPERISLEFFFQEYFR
LLPEYQKINLDQLQWQRFLSGFFPAYKSSPLHFSWGRVLAVGDSAGSQSPVSFGGFGAMV
RHLKRLTNAIGEALAGDYLAAEDLALLQPYQPNIGVTWLFQQTMGVKVGQTADPEQINRL
MNAVFAVMDRQGQEVMEPFLQDVIQWSGLTQTLPRVNPLIVLPLLPQIGLPALMEWLGHY
ANLAGYSLTYPLAKNLLFTNPSFEQKRRLEAWYYGSGYDFHH
Download sequence
Identical sequences L8ANT3 Q55984
gi|16331966|ref|NP_442694.1| 1148.sll0659 WP_010873989.1.11876 WP_010873989.1.1889 WP_010873989.1.18904 WP_010873989.1.33690 WP_010873989.1.35395 WP_010873989.1.47586 WP_010873989.1.99424 gi|383492762|ref|YP_005410439.1| gi|383323709|ref|YP_005384563.1| SgR65 gi|383326878|ref|YP_005387732.1| gi|16331966|ref|NP_442694.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]