SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_010878613.1.34637 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_010878613.1.34637
Domain Number 1 Region: 83-180
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 9.7e-24
Family Cold shock DNA-binding domain-like 0.0000496
Further Details:      
 
Domain Number 2 Region: 1-78
Classification Level Classification E-value
Superfamily N-terminal, heterodimerisation domain of RBP7 (RpoE) 3.92e-22
Family N-terminal, heterodimerisation domain of RBP7 (RpoE) 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_010878613.1.34637
Sequence length 189
Comment DNA-directed RNA polymerase [Archaeoglobus fulgidus]; AA=GCF_900069765.1; RF=na; TAX=2234; STAX=2234; NAME=Archaeoglobus fulgidus; AL=Contig; RT=Major
Sequence
MYARIKLRDTVRVPPSKLGEDIEKVINSLLWEQFEGRLDREYGMIIGIESIEEIGEGRII
EGDGGVYFDVVFNAICFRPLHQEVVEGEVIEIVEFGAFVSIGPFDALLHMSQVTDDYMVF
DEKNKRLVGRETKKVLQEGDKVRARIVSLSLKEREPEKSKIGLTMRQPWLGALKWIEEEI
EKLMKESGV
Download sequence
Identical sequences A0A075WK92 A0A101E341 O29148
gi|11498717|ref|NP_069946.1| WP_010878613.1.27515 WP_010878613.1.34637 WP_010878613.1.46508 224325.AF1117

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]