SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_010902366.1.50382 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_010902366.1.50382
Domain Number 1 Region: 172-257
Classification Level Classification E-value
Superfamily eIF-2-alpha, C-terminal domain 1.57e-22
Family eIF-2-alpha, C-terminal domain 0.003
Further Details:      
 
Domain Number 2 Region: 83-171
Classification Level Classification E-value
Superfamily eIF2alpha middle domain-like 2.16e-19
Family eIF2alpha middle domain-like 0.0046
Further Details:      
 
Domain Number 3 Region: 4-84
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.57e-18
Family Cold shock DNA-binding domain-like 0.00096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_010902366.1.50382
Sequence length 267
Comment translation initiation factor IF-2 subunit alpha [Halobacterium salinarum]; AA=GCF_000006805.1; RF=representative genome; TAX=64091; STAX=2242; NAME=Halobacterium salinarum NRC-1; strain=NRC-1; ATCC 700922; AL=Complete Genome; RT=Major
Sequence
MKYEGWPDEGELVVGKVDDIEDFGVFVDLEQYQDKRGLVHVSEVASGWIKNVRDHVNEDQ
TVVAKVLGVDESAQQIDLSLKDVNDHQHSDTIQEWKNEQKADKWLTLAFGEDMADDQFRR
IANGLLADFGSLYDGFEQAAIHGHEALADTALEDDEIDAIVETARDNVSVPYVTVTGYVS
LQSPDGDGVDTIKDALQAAEGNGEVPDEVDLDVTYVGAPEYRLRVQAPNYKTAESALEAA
GDRAVDSVTAHDGSGAFHRERQLDDDA
Download sequence
Identical sequences B0R3M0 Q9HRT8
gi|169235483|ref|YP_001688683.1| gi|15789766|ref|NP_279590.1| WP_010902366.1.1784 WP_010902366.1.50382 478009.OE1818R 64091.VNG0549G

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]