SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011011188.1.59273 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011011188.1.59273
Domain Number 1 Region: 41-294
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.91e-77
Family Glycosyl hydrolases family 16 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011011188.1.59273
Sequence length 297
Comment endo-beta-1,3-glucanase [Pyrococcus furiosus]; AA=GCF_000007305.1; RF=representative genome; TAX=186497; STAX=2261; NAME=Pyrococcus furiosus DSM 3638; strain=DSM 3638; AL=Complete Genome; RT=Major
Sequence
MKKEALLFLSLIFLVFVSGCIHHSTNQQLSSKQQVPEVIEIDGKQWRLIWHDEFEGSEVN
KEYWTFEKGNGIAYGIPGWGNGELEYYTENNTYIVNGTLVIEARKEIITDPNEGTFLYTS
SRLKTEGKVEFSPPVVVEARIKLPKGKGLWPAFWMLGSNIREVGWPNCGEIDIMEFLGHE
PRTIHGTVHGPGYSGSKGITRAYTLPEGVPDFTEDFHVFGIVWYPDKIKWYVDGTFYHEV
TKEQVEAMGYEWVFDKPFYIILNLAVGGYWPGNPDATTPFPAKMVVDYVRVYSFVSG
Download sequence
Identical sequences E7FHE7 I6V2Y2 O73951
gi|397652209|ref|YP_006492790.1| 186497.PF0076 WP_011011188.1.13913 WP_011011188.1.59273 gi|18976448|ref|NP_577805.1| Pfu-82406-001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]