SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011023639.1.43275 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011023639.1.43275
Domain Number 1 Region: 2-67
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000921
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011023639.1.43275
Sequence length 76
Comment MULTISPECIES: hypothetical protein [Methanosarcina]; AA=GCF_000970085.1; RF=representative genome; TAX=1434120; STAX=38027; NAME=Methanosarcina siciliae T4/M; strain=T4/M; AL=Complete Genome; RT=Major
Sequence
MKCYECAREGKDTDAVGICIVCGRGVCKEHLIHEETPAWEGDYPIELKPDKEHIKRIVCV
PCHEALKENCLFNEVC
Download sequence
Identical sequences A0A0E3LBH4 A0A0E3P7L9 A0A0E3PT84 Q8TJP5
gi|20092532|ref|NP_618607.1| 188937.MA3734 WP_011023639.1.11460 WP_011023639.1.43275 WP_011023639.1.98848

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]