SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011028437.1.58943 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_011028437.1.58943
Domain Number - Region: 56-113
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 0.0719
Family Gelsolin-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011028437.1.58943
Sequence length 176
Comment MULTISPECIES: hypothetical protein [Streptomyces]; AA=GCF_900104935.1; RF=na; TAX=1881022; STAX=1881022; NAME=Streptomyces sp. 2114.2; strain=2114.2; AL=Chromosome; RT=Major
Sequence
MSGVRPGTAAPRGGTASRGGAGARGGTGARPGGARGANRAGGEERALTSVAAGDRFHGEE
PEHTPRLWHVTLSVSGARAPLTEVRRALEQLAHDHPFLLTSRYADDHAEIRYWEEARDLH
DAAAVALRLWGEHRQTAGLPPWEIVGLEVIDRATYHQRIAAGYGPAPATPVGVHPF
Download sequence
Identical sequences A0A076M664 A0A1H2A486 Q9RDK0
100226.SCO2586 gi|21221045|ref|NP_626824.1| NP_626824.1.49638 WP_011028437.1.26049 WP_011028437.1.30910 WP_011028437.1.55229 WP_011028437.1.58943

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]